Amyloid Precursor Protein, (APP) (721 - 770)

Amyloid Precursor Protein, (APP) (721 - 770)
Sequence (1LC):
VMLKKKQYTSIHHGVVEVDAAVTPEERHLSKMQQNGYENPTYKFFEQMQN
Sequence (3LC):
NH2 - Val - Met - Leu - Lys - Lys - Lys - Gln - Tyr - Thr - Ser - Ile - His - His - Gly - Val - Val - Glu - Val - Asp - Ala - Ala - Val - Thr - Pro - Glu - Glu - Arg - His - Leu - Ser - Lys - Met - Gln - Gln - Asn - Gly - Tyr - Glu - Asn - Pro - Thr - Tyr - Lys - Phe - Phe - Glu - Gln - Met - Gln - Asn - COOH
Catalog :
13916-005
Unit:
0.5 mg
Price/Unit:
$1,544  (For other quantities please Contact Us or call 972-420-8505 (USA) 800-227-0627 (INTL.) or Fax 972.420.0442)
Purity:
>95%
Format:
Each vial contains lyophilized solid packaged under an inert gas and supplied as a trifluoroacetate salt
Description:
This is amino acids 721 to 770 fragment of the amyloid precursor protein resulting from the g-secretase cleavage of the C-terminus of beta-amyloid precursor protein (APP) at Leu720-Val721. This peptide is also known as CTF50-99. The mutation at Leu723 (L723P) causes familial Alzheimer’s disease.
Storage:
Store the peptide at -20°C. Keep container tightly
Product Usage:
This product is for research use only. Not for use in diagnostic or therapeutic procedures.
M.W.:
5910.7 g/mol
Reference/Citations:
  1. Gu, Y., et al. J. Biol. Chem. 276, 35235 (2001);
  2. Kwok, J. et al. Ann. Neurol. 47, 249 (2000).

Why Choose Bio-Synthesis

Trusted by biotech leaders worldwide for over 40+ years of delivering high quality, fast and scalable synthetic biology solutions.