[Asn7] - beta - Amyloid (1 - 42), Tottori - Japanese Mutation

[Asn7] - beta - Amyloid (1 - 42), Tottori - Japanese Mutation
Sequence (1LC):
DAEFRHNSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Sequence (3LC):
NH2 - Asp - Ala - Glu - Phe - Arg - His - Asn - Ser - Gly - Tyr - Glu - Val - His - His - Gln - Lys - Leu - Val - Phe - Phe - Ala - Glu - Asp - Val - Gly - Ser - Asn - Lys - Gly - Ala - Ile - Ile - Gly - Leu - Met - Val - Gly - Gly - Val - Val - Ile - Ala - COOH
Catalog :
13795-005
Unit:
0.5 mg
Price/Unit:
$878  (For other quantities please Contact Us or call 972-420-8505 (USA) 800-227-0627 (INTL.) or Fax 972.420.0442)
Purity:
>95%
Format:
Each vial contains lyophilized solid packaged under an inert gas and supplied as a trifluoroacetate salt
Description:
This b-amyloid (1-42) contains the Tottori-Japanese (D7N) mutation where Asp7 is replaced by Asn7. In vitro analysis using beta-amyloid 1 to 40-based mutant peptide reveals that the D7N mutation does not accelerate the nucleation phase but selectively promotes the elongation phase of amyloid fibril formation. The levels of protofibrils generated from D7N beta-amyloid were markedly inhibited despite enhanced fibril formation.
Storage:
Store the peptide at -20°C. Keep container tightly
Product Usage:
This product is for research use only. Not for use in diagnostic or therapeutic procedures.
M.W.:
4513.1 g/mol
Reference/Citations:
  1. Hori, Y. et al. J. Biol. Chem. 282, 4916 (2007).

Why Choose Bio-Synthesis

Trusted by biotech leaders worldwide for over 45+ years of delivering high quality, fast and scalable synthetic biology solutions.