Beta - Amyloid (1 - 39), mouse, rat

Beta - Amyloid (1 - 39), mouse, rat
Sequence (1LC):
DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGV
Sequence (3LC):
NH2 - Asp - Ala - Glu - Phe - Gly - His - Asp - Ser - Gly - Phe - Glu - Val - Arg - His - Gln - Lys - Leu - Val - Phe - Phe - Ala - Glu - Asp - Val - Gly - Ser - Asn - Lys - Gly - Ala - Ile - Ile - Gly - Leu - Met - Val - Gly - Gly - Val - COOH
Catalog :
13899-005
Unit:
0.5 mg
Price/Unit:
$990  (For other quantities please Contact Us or call 972-420-8505 (USA) 800-227-0627 (INTL.) or Fax 972.420.0442)
Purity:
>95%
Format:
Each vial contains lyophilized solid packaged under an inert gas and supplied as a trifluoroacetate salt
Description:
This is amino acids 1 to 39 fragment of mouse and rat beta-amyloid. It differs from human beta-amyloid by three amino acid residues: Arg5, Tyr10, and His13 residues in human beta-amyloid correspond to Gly5, Phe10, and Arg13 in mice and rat sequence.
Storage:
Store the peptide at -20°C. Keep container tightly
Product Usage:
This product is for research use only. Not for use in diagnostic or therapeutic procedures.
M.W.:
4134.7 g/mol

Why Choose Bio-Synthesis

Trusted by biotech leaders worldwide for over 45+ years of delivering high quality, fast and scalable synthetic biology solutions.