Beta - Amyloid (5 - 40) - Lys(LC - Biotin) - NH2

Beta - Amyloid (5 - 40) - Lys(LC - Biotin) - NH2
Sequence (1LC):
RHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV-K(LC-biotin)-CONH2
Sequence (3LC):
NH2 - Arg - His - Asp - Ser - Gly - Tyr - Glu - Val - His - His - Gln - Lys - Leu - Val - Phe - Phe - Ala - Glu - Asp - Val - Gly - Ser - Asn - Lys - Gly - Ala - Ile - Ile - Gly - Leu - Met - Val - Gly - Gly - Val - Val - Lys(LC - Biotin) - CONH2
Catalog :
13874-01
Unit:
1 mg
Price/Unit:
$1,956  (For other quantities please Contact Us or call 972-420-8505 (USA) 800-227-0627 (INTL.) or Fax 972.420.0442)
Purity:
>95%
Format:
Each vial contains lyophilized solid packaged under an inert gas and supplied as a trifluoroacetate salt
Description:
This is amino acids 5 to 40 fragment of the beta-amyloid peptide. This amino-truncated amyloid peptide produced from caspase-cleaved amyloid precursor protein is deposited in Alzheimer’s disease brain. Cleavage between Phe4 and Arg5 is not mediated by BACE1. The peptide is biotinylated at N-terminal Cysteine.
Storage:
Store the peptide at -20°C. Keep container tightly
Product Usage:
This product is for research use only. Not for use in diagnostic or therapeutic procedures.
M.W.:
4334.1 g/mol

Why Choose Bio-Synthesis

Trusted by biotech leaders worldwide for over 40+ years of delivering high quality, fast and scalable synthetic biology solutions.