Gamma Interferon (95 - 125), IFN - γ (95 - 125), mouse

Gamma Interferon (95 - 125), IFN - γ (95 - 125), mouse
Sequence (1LC):
AKFEVNNPQVQRQAFNELIRVVHQLLPESSL
Sequence (3LC):
NH2 - Ala - Lys - Phe - Glu - Val - Asn - Asn - Pro - Gln - Val - Gln - Arg - Gln - Ala - Phe - Asn - Glu - Leu - Ile - Arg - Val - Val - His - Gln - Leu - Leu - Pro - Glu - Ser - Ser - Leu - COOH
Catalog :
14207-01
Unit:
1 mg
Price/Unit:
$1,119  (For other quantities please Contact Us or call 972-420-8505 (USA) 800-227-0627 (INTL.) or Fax 972.420.0442)
Purity:
>95%
Format:
Each vial contains lyophilized solid packaged under an inert gas and supplied as a trifluoroacetate salt
Description:
This peptide is murine interferon (IFN)-γ (95-125). This peptide can be used as a negative control to IFN-γ (95-132), which has been shown to have antiviral effects against the herpes simplex virus, vaccinia virus, encephalomyocarditis virus, and vesicular stomatitis virus. This peptide lacks the nuclear localization sequence required for antiviral activity.
Storage:
Store the peptide at -20°C. Keep container tightly
Product Usage:
This product is for research use only. Not for use in diagnostic or therapeutic procedures.
M.W.:
3605.1 g/mol
Reference/Citations:
1. Frey, K. et al. J Immunol 183, 1253 (2009);
2. Ahmed, C. et al. J Immunol 178, 4576 (2007);
3. Otero, M. et al. Arthritis Res Ther7, 581 (2005).

Why Choose Bio-Synthesis

Trusted by biotech leaders worldwide for over 45+ years of delivering high quality, fast and scalable synthetic biology solutions.