[Val22] - beta - Amyloid (1 - 42); E22V beta - Amyloid (1 - 42)

[Val22] - beta - Amyloid (1 - 42); E22V beta - Amyloid (1 - 42)
Sequence (1LC):
DAEFRHDSGYEVHHQKLVFFAVDVGSNKGAIIGLMVGGVVIA
Sequence (3LC):
NH2 - Asp - Ala - Glu - Phe - Arg - His - Asp - Ser - Gly - Tyr - Glu - Val - His - His - Gln - Lys - Leu - Val - Phe - Phe - Ala - Val - Asp - Val - Gly - Ser - Asn - Lys - Gly - Ala - Ile - Ile - Gly - Leu - Met - Val - Gly - Gly - Val - Val - Ile - Ala - COOH
Catalog :
13785-01
Unit:
1 mg
Price/Unit:
$1,638  (For other quantities please Contact Us or call 972-420-8505 (USA) 800-227-0627 (INTL.) or Fax 972.420.0442)
Purity:
>95%
Format:
Each vial contains lyophilized solid packaged under an inert gas and supplied as a trifluoroacetate salt
Description:
This peptide represents beta-amyloid (1-42) with substitution of Glu22 to Val. Turn formation between residues 22 and 23 has been shown to be crucial to neurotoxicity and aggregative ability of Ab. Substitution to valine, a residue rarely found in two-residue b-turns, decreases neurotoxicity and aggregation of amyloid fibrils.
Storage:
Store the peptide at -20°C. Keep container tightly
Product Usage:
This product is for research use only. Not for use in diagnostic or therapeutic procedures.
M.W.:
4484.1 g/mol
Reference/Citations:
  1. Murakami, K. et al. Geriatr Gerontol Int 10, 169 (2010);
  2. Murakami, K. et al. J Biol Chem 278, 46179 (2003).

Why Choose Bio-Synthesis

Trusted by biotech leaders worldwide for over 45+ years of delivering high quality, fast and scalable synthetic biology solutions.