Header

Header

Header

Ova Peptides Products

Definition
OVA Peptide is a class I (Kb)-restricted peptide epitope of ovalbumin presented by the class I MHC (major histocompatibility complex) molecule, H-2Kb (class I genes of the mouse MHC).

Discovery
Several ovalbumin (OVA) peptides have been used for studies of IgE response, CD4+ T cells response, immediate cutaneous hypersensitivity and airways responsiveness (AR). Renz H et al.,in 1993 have analyzed the effects of sensitization of BALB/c mice to the OVA peptide amino acids 323-339, on the development of an IgE response. Daily aerosolization of OVA 323-339 for 20 minutes over a period of 10 days was as effective in the stimulation of a serum anti-OVA IgE antibody response as sensitization to native OVA by the same route.1 Ingulli E et al., in 1997 used confocal microscopy to track the in vivo location of fluorescent dye-labeled DC and naive TCR transgenic CD4+ T cells specific for an OVA peptide–I-Ad complex after adoptive transfer into syngeneic recipients.2

Structural Characteristics
Ovalbumin is a 43 kDa protein. OVA peptides  (257 - 264), H - Ser - Ile - Ile - Asn - Phe - Glu - Lys - Leu – OH, is a class I (Kb)-restricted peptide epitope of OVA, an octameric peptide from ovalbumin presented by the class I MHC molecule, H-2Kb.3 OVA (323 - 339) peptide sequence is H - Ile - Ser - Gln - Ala - Val - His - Ala - Ala - His - Ala - Glu - Ile - Asn - Glu - Ala - Gly - Arg – OH, An H-2b-restricted OVA class II epitope.4

Mode of Action
Proteins of the class II MHC bind antigenic peptides that are subsequently presented to T cells. Most of the residues required for binding of the chicken ovalbumin (Ova) 323-339 peptide to the I-A(d) MHC class II protein are contained within the shorter 325-336 peptide. Two Ova peptides, Ova (323-335) and Ova (325-336), were found to dissociate from I-A(d) with distinct kinetics. The dissociation rates for both peptides were enhanced when the His81 residue of the MHC beta-chain was replaced with an Asparagine. In the structure the betaH81 residue forms a hydrogen bond to the backbone carbonyl of I323. If the Ova (325-336) peptide were also bound in the register, there would be no comparable hydrogen-bond acceptor for the betaH81 side chain that could explain this peptide's sensitivity to the betaH81 replacement. The Ova (323-335) peptide that binds in the register does not stimulate a T-cell hybridoma that is stimulated by Ova (325-336) bound in the alternate register. These results demonstrate that a single peptide can bind to an MHC peptide in alternate registers producing distinct T-cell responses.5 Lymphoid dendritic cells (DC) are thought to play an essential role in T cell activation, the initial physical interaction between antigen-bearing DC. DC that were not exposed to the OVA peptide, homed to the paracortical regions of the lymph nodes but did not interact with the OVA peptide-specific T cells. In contrast, the OVA peptide-specific T cells formed large clusters around paracortical DC that were pulsed in vitro with the OVA peptide before injection. Interactions were also observed between paracortical DC of the recipient and OVA peptide-specific T cells after administration of intact OVA. Injection of OVA peptide-pulsed DC caused the specific T cells to produce IL-2 in vivo, proliferate, and differentiate into effector cells capable of causing a delayed-type hypersensitivity reaction. By 48 hours after injection, OVA peptide-pulsed, but not unpulsed DC disappeared from the lymph nodes of mice that contained the transferred TCR transgenic population. These results demonstrate that antigen-bearing DC directly interact with naive antigen-specific T cells within the T cell–rich regions of lymph nodes. This interaction results in T cell activation and disappearance of the DC.2

Functions
Effects of sensitization of BALB/c mice to the OVA peptide amino acids 323-339, on the development of an IgE response, immediate cutaneous hypersensitivity and airways responsiveness (AR) were analyzed. Data indicates that OVA peptide 323-339 represents a T and B cell epitope of OVA, which is important in the generation and development of immediate hypersensitivity responses in BALB/c mice.1

OVA - BIP Hybrid Peptide, This is a hybrid peptide containing OVA-Bip motif that binds to the Heat Shock Proteins (HSP 70) through the Bip sequence. Heat shock proteins derived from tumors or virally infected cells can stimulate antigen-specific CD8+ T cell responses in-vitro and in-vivo. The binding motif of HSP 70 consists of a hydrophobic core of four to five amino acids and two flanking regions enriched in basic residues.6

Cowpox virus (CPXV), a close relative of the deadly variola virus causing smallpox, is primarily a lung pathogen and is known to transmit through aerosols. CPXV suppresses dendritic cell function in vitro and leaves them unable to stimulate T cells. OVA323-339 peptide was used as second antigen and showed that a lethal CPXV infection reduces DO11.10 T cell proliferation in the lung-associated lymph node (LALN), while proliferation can still occur during a sublethal infection.7

References

  1. Renz H, Bradley K, Larsen GL, McCall C, Gelfand EW, (1993). Comparison of the allergenicity of ovalbumin and ovalbumin peptide 323- 339. Differential expansion of V beta-expressing T cell populations. The Journal of Immunology,
  1. Ingulli E, Mondino A, Khoruts A, Jenkins MK (1997). In Vivo Detection of Dendritic Cell Antigen Presentation to CD4+ T Cells.  The Journal of Experimental Medicine.,
  1. Honma K, Kohno Y, Saito K, Shimojo N, Horiuchi T, Hayashi H, Suzuki N, Hosoya T, Tsunoo H, Niimi H (2007). Allergenic epitopes of ovalbumin (OVA) in patients with hen's egg allergy: inhibition of basophil histamine release by haptenic ovalbumin peptide. Clin. Exp. Immunol., 103(3):446-453.
  1. Oran A, Robinson H (2003). DNA vaccines, combining form of antigen and method of delivery to raise a spectrum of IFN-gamma and IL-4-producing CD4+ and CD8+ T cells. J. Immunol. ,< 1999-2005.>
  1. McFarland BJ, Sant AJ, Lybrand TP, Beeson C (1999). Ovalbumin(323-339) peptide binds to the major histocompatibility complex class II I-A(d) protein using two functionally distinct registers. Biochemistry,
  1. Castellino F, Boucher PE, Eichelberg K, Mayhew M, Rothman JE, Houghton AN, Germain RN (2000).  Receptor-mediated uptake of antigen/heat shock protein complexes results in major histocompatibility complex class I antigen presentation via two distinct processing pathways. J. Exp. Med., 191(11):1957-1964.
  1. Hrusch CL, Lipsomb M, Wilder J, Lyons R (2009). Cowpox immunomodulation of a pulmonary immune response to OVA-peptide. The FASEB journal,

ALL
A
B
C
D
E
F
G
H
I
J
K
L
M
N
O
P
Q
R
S
T
U
V
W
X
Y
Z

If you are unable to find your desired product please contact us for assistance or send an email to info@biosyn.com

 
Product Name Catalog # Unit Price/Unit 
β - catenin peptide, (βCATp)  NEW
RTYTYEKL
12791-01 1 mg $710 Cart Inquire
E1, (E257)
EIINFEKL
12792-01 1 mg $710 Cart Inquire
MSL8, [Met256] - OVA (257 - 264)
MSIINFEKL
12795-01 1 mg $743 Cart Inquire
OVA (241 - 270)
SMLVLLPDEVSGLEQLESIINFEKLTEWTS
14801-01 1 mg $689 Cart Inquire
OVA (257 - 264)
SIINFEKL
12788-01 1 mg $405 Cart Inquire
OVA (257 - 264), amide
SIINFEKL-CONH2
12794-01 1 mg $728 Cart Inquire
OVA (257 - 264) FAM labeled
5 - FAM - SIINFEKL - NH2
14802-01 1 mg $743 Cart Inquire
OVA (257 - 264) scrambled FILKSINE
FILKSINE
14803-01 1 mg $405 Cart Inquire
OVA (257 - 264) Variant E1
Pyr-IINFEKL
12790-01 1 mg $728 Cart Inquire
OVA (323 - 339)
ISQAVHAAHAEINEAGR
12787-01 1 mg $405 Cart Inquire
OVA (323 - 339) amide
ISQAVHAAHAEINEAGR-CONH2
12793-01 1 mg $405 Cart Inquire
OVA (323 - 339) biotin - labeled
Biotin - ISQAVHAAHAEINEAGR
14804-01 1 mg $540 Cart Inquire
OVA (323 - 339) FITC - labeled
FITC - LC - ISQAVHAAHAEINEAGR
14805-01 1 mg $818 Cart Inquire
OVA (323 - 339) TAMRA labeled
5 - TAMRA - ISQAVHAAHAEINEAGR
14806-01 1 mg $912 Cart Inquire
OVA (327 - 333)
VHAAHAE
12796-01 1 mg $710 Cart Inquire
OVA (329 - 337)
AAHAEINEA
14807-01 1 mg $405 Cart Inquire
OVA - A2 Peptide SAINFEKL OVA (257 - 264) Variant
SAINFEKL
14808-01 1 mg $405 Cart Inquire
OVA - BIP Hybrid Peptide
SIINFEKLGSGHWDFAWPW
12789-01 1 mg $828 Cart Inquire
OVA - G4 Peptide SIIGFEKL OVA (257 - 264) Variant
SIIGFEKL
14809-01 1 mg $405 Cart Inquire
OVA - Q4H7 Peptide pQ4H7 SIIQFEHL OVA (257 - 264) Variant
SIIQFEHL
14811-01 1 mg $405 Cart Inquire
OVA - Q4 Peptide pQ4 SIIQFEKL OVA (257 - 264) Variant
SIIQFEKL
14810-01 1 mg $405 Cart Inquire
OVA - T4 Peptide SIITFEKL pT4 OVA (257 - 264) Variant
SIITFEKL
14812-01 1 mg $405 Cart Inquire

Biosynthesis Inc.

Why Choose Bio-Synthesis

Trusted by biotech leaders worldwide for over 45+ years of delivering high quality, fast and scalable synthetic biology solutions.